DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and SC35

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:100 Identity:34/100 - (34%)
Similarity:52/100 - (52%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALA 129
            ||....:.:.|.|.:|......|::...|..||::.::.:..|||||.|:|:|.|.|:...:|..
plant     8 GPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHK 72

  Fly   130 AKEALNGAEIMGQTIQVDWCFVK-GPKRVKKSEKR 163
            |.|.|:|..:.|:.|.|.  |.| ||...|.|:.|
plant    73 AVERLDGRVVDGREITVQ--FAKYGPNAEKISKGR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 4/14 (29%)
RRM_RBM8 67..154 CDD:409762 27/87 (31%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 24/71 (34%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.