DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and GR-RBP3

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_200911.1 Gene:GR-RBP3 / 836224 AraportID:AT5G61030 Length:309 Species:Arabidopsis thaliana


Alignment Length:74 Identity:24/74 - (32%)
Similarity:46/74 - (62%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..:.....||.::|.|..|||:.:..:.|||.||.|:|:..|.:.:.:.|.:|.:||:|.::
plant    42 LFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDL 106

  Fly   140 MGQTIQVDW 148
            .|:.::|::
plant   107 HGRVVKVNY 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 24/74 (32%)
GR-RBP3NP_200911.1 RRM 39..120 CDD:440488 24/74 (32%)

Return to query results.
Submit another query.