DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT5G59860

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_200794.1 Gene:AT5G59860 / 836108 AraportID:AT5G59860 Length:157 Species:Arabidopsis thaliana


Alignment Length:57 Identity:19/57 - (33%)
Similarity:30/57 - (52%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWC-FVKGPKRVKKSEK 162
            |::|...||:..:.:|:...|..|.:||||..:.|:.|.|:.. .|:.|....||.|
plant   100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAKEVEAPTTSLKSNK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520
RRM_RBM8 67..154 CDD:409762 15/47 (32%)
AT5G59860NP_200794.1 RRM 73..144 CDD:440488 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.