DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT5G54580

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_200269.1 Gene:AT5G54580 / 835546 AraportID:AT5G54580 Length:156 Species:Arabidopsis thaliana


Alignment Length:74 Identity:18/74 - (24%)
Similarity:38/74 - (51%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||:.:.:....:.::..|..:||:.:..:..||.:|:|||:..|.|.|.:.:......::|..:
plant    58 LFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDGKFL 122

  Fly   140 MGQTIQVDW 148
            .|..|..::
plant   123 DGWVIFAEY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 18/74 (24%)
AT5G54580NP_200269.1 RRM 55..138 CDD:440488 18/74 (24%)

Return to query results.
Submit another query.