DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and Cstf2t

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_112539.2 Gene:Cstf2t / 83410 MGIID:1932622 Length:632 Species:Mus musculus


Alignment Length:85 Identity:31/85 - (36%)
Similarity:49/85 - (57%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQA 127
            :|...||:..  :||.:|..||.|:::::.|.:.|.:.:..|..||.||..|||...||:..:.|
Mouse     8 DPAMDRSLRS--VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETA 70

  Fly   128 LAAKEALNGAEIMGQTIQVD 147
            |:|...|||.|..|:.::||
Mouse    71 LSAMRNLNGREFSGRALRVD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 5/16 (31%)
RRM_RBM8 67..154 CDD:409762 30/81 (37%)
Cstf2tNP_112539.2 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/83 (36%)
CSTF2_hinge 112..191 CDD:433869
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..433
8 X 5 AA tandem repeats of M-E-T-R-[AG] 428..466
12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 508..565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..590
CSTF_C 588..628 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.