DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and CCR1

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_195637.1 Gene:CCR1 / 830082 AraportID:AT4G39260 Length:169 Species:Arabidopsis thaliana


Alignment Length:72 Identity:20/72 - (27%)
Similarity:39/72 - (54%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIM 140
            ||..:.....::::|..|..:|::.:..:..||.:|.|:|:..|.::..|....|.|.:||.|:.
plant     9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELD 73

  Fly   141 GQTIQVD 147
            |:.|.|:
plant    74 GRVITVN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/3 (67%)
RRM_RBM8 67..154 CDD:409762 20/72 (28%)
CCR1NP_195637.1 RRM2_NsCP33_like 7..82 CDD:410187 20/72 (28%)

Return to query results.
Submit another query.