DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT4G26650

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_567753.1 Gene:AT4G26650 / 828772 AraportID:AT4G26650 Length:455 Species:Arabidopsis thaliana


Alignment Length:85 Identity:20/85 - (23%)
Similarity:43/85 - (50%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..|..:..|:.:||.|..||::....:..||.||.::|:..:.:.  ..::|.:..::...|
plant    17 LFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFA--DPSVAERVIMDKHII 79

  Fly   140 MGQTIQVDWCFVKGPKRVKK 159
            .|:|::......:..::|.|
plant    80 DGRTVEAKKAVPRDDQQVLK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 18/78 (23%)
AT4G26650NP_567753.1 RRM1_hnRNPA_hnRNPD_like 17..87 CDD:409763 18/71 (25%)
RRM2_Hrp1p 123..200 CDD:409767
ser_rich_anae_1 <204..>385 CDD:468206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.