DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBP31

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_194208.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:154 Identity:34/154 - (22%)
Similarity:66/154 - (42%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GIVRLKEKAKHR---KGRGFG--SDSNTREAIHSYERVRNED--------------DDELEPGPQ 67
            |.|.:.|...:|   :.||||  :.|:..||..:.|:....|              ....|..|:
plant   174 GTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPR 238

  Fly    68 RSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKE 132
            .....:.::|.::..:.....:::.|.::|::....:..||.||.|:|:..|......:...|..
plant   239 VYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAIS 303

  Fly   133 ALNGAEIMGQTIQVDWCFVKGPKR 156
            ||:|..:.|:.|:|:....:.|:|
plant   304 ALDGQNLEGRAIRVNVAEERPPRR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 16/76 (21%)
RRM_RBM8 67..154 CDD:409762 17/86 (20%)
RBP31NP_194208.1 DNA_pol_phi <87..150 CDD:461488
RRM1_PSRP2_like 151..230 CDD:410188 13/55 (24%)
RRM 245..327 CDD:440488 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.