DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and SR34b

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001328194.1 Gene:SR34b / 828027 AraportID:AT4G02430 Length:292 Species:Arabidopsis thaliana


Alignment Length:73 Identity:20/73 - (27%)
Similarity:38/73 - (52%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ::|.::..:.:|.|:::.|..||.:..|.|.:..|   ..|||.||:|..:.|..|....:|.:.
plant     9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR---PPGYAFVEFEDARDADDAIYGRDGYDF 70

  Fly   140 MGQTIQVD 147
            .|..::|:
plant    71 DGHHLRVE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 1/4 (25%)
RRM_RBM8 67..154 CDD:409762 20/73 (27%)
SR34bNP_001328194.1 RRM1_SF2_plant_like 8..79 CDD:410011 20/73 (27%)
RRM2_SF2_plant_like 120..192 CDD:410014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.