DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT4G20030

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:82 Identity:23/82 - (28%)
Similarity:39/82 - (47%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            :.|.::.....||.::.:|..:|||..:.|..|.....|||||.:::.:...|..|.|.::....
plant    42 IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMY 106

  Fly   140 MGQTIQVDWCFVKGPKR 156
            .|:.|.:|  ..|..||
plant   107 NGRMIYID--IAKPGKR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 1/4 (25%)
RRM_RBM8 67..154 CDD:409762 21/78 (27%)
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 19/70 (27%)

Return to query results.
Submit another query.