DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and GR-RBP2

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_193121.1 Gene:GR-RBP2 / 827019 AraportID:AT4G13850 Length:158 Species:Arabidopsis thaliana


Alignment Length:73 Identity:19/73 - (26%)
Similarity:40/73 - (54%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..:.....:..:::.|..:|::.:..:.:||.||.|:|:..|.:.....|.||...::|.|:
plant    37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKEL 101

  Fly   140 MGQTIQVD 147
            .|:.|:|:
plant   102 NGRHIRVN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 19/73 (26%)
GR-RBP2NP_193121.1 PLN03134 1..143 CDD:178680 19/73 (26%)

Return to query results.
Submit another query.