DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RS2Z32

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_190918.3 Gene:RS2Z32 / 824518 AraportID:AT3G53500 Length:284 Species:Arabidopsis thaliana


Alignment Length:73 Identity:17/73 - (23%)
Similarity:34/73 - (46%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |:|..:....:..:::..|..||.::::.:..|        ||.||:...:.|..|:..|:|.:.
plant    13 LYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD--------YAFVEFSDPRDADDARYYLDGRDF 69

  Fly   140 MGQTIQVD 147
            .|..|.|:
plant    70 DGSRITVE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 17/73 (23%)
RS2Z32NP_190918.3 RRM_SF 12..81 CDD:473069 17/73 (23%)
PTZ00368 <86..142 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.