DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and ATRZ-1A

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_189273.1 Gene:ATRZ-1A / 822246 AraportID:AT3G26420 Length:245 Species:Arabidopsis thaliana


Alignment Length:72 Identity:19/72 - (26%)
Similarity:38/72 - (52%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIM 140
            |:..:.....:..:::.|..||.:....:.||:.:|.|:|:..:.::..|....|..|:||.::.
plant    10 FIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLD 74

  Fly   141 GQTIQVD 147
            |:||.||
plant    75 GRTITVD 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 1/3 (33%)
RRM_RBM8 67..154 CDD:409762 19/72 (26%)
ATRZ-1ANP_189273.1 RRM2_NsCP33_like 8..83 CDD:410187 19/72 (26%)
ZnF_C2HC 120..135 CDD:197667
U2AF_lg 136..>242 CDD:273727
PRK04537 <208..240 CDD:235307
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.