DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT3G08000

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:96 Identity:24/96 - (25%)
Similarity:54/96 - (56%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..:.....|..:::.|..:||:..:.:..|:.:|.|:|:..|::.....||:||:|::|..:
plant    43 LFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGKGL 107

  Fly   140 MGQTIQVDWCFVK---GP---KRVKKSEKRR 164
            :|:.:::.:...:   ||   .|:.||::.|
plant   108 LGRPLRISFALERVRGGPVVVPRLGKSKRER 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 18/81 (22%)
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 18/80 (23%)

Return to query results.
Submit another query.