DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RS2Z33

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:82 Identity:20/82 - (24%)
Similarity:38/82 - (46%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |:|..:....:..:::..|..||.::::.:..|        ||.||:...:.|..|:..|:|.:.
plant    13 LYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD--------YAFVEFGDPRDADDARHYLDGRDF 69

  Fly   140 MGQTIQVDWCFVKGPKR 156
            .|..|.|:  |.:|..|
plant    70 DGSRITVE--FSRGAPR 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 18/78 (23%)
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:473069 18/77 (23%)
PTZ00368 <86..144 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.