DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT2G27330

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_565646.2 Gene:AT2G27330 / 817276 AraportID:AT2G27330 Length:116 Species:Arabidopsis thaliana


Alignment Length:73 Identity:19/73 - (26%)
Similarity:38/73 - (52%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||..|...:.|:.:.:.|..||::..:.:.:|:.....||:|.|.:.:.::|..|...||...:
plant    23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLV 87

  Fly   140 MGQTIQVD 147
            .|:.:.:|
plant    88 DGRVVILD 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 19/73 (26%)
AT2G27330NP_565646.2 RRM_SF 23..99 CDD:473069 19/73 (26%)

Return to query results.
Submit another query.