DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and GRP7

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_179760.1 Gene:GRP7 / 816705 AraportID:AT2G21660 Length:176 Species:Arabidopsis thaliana


Alignment Length:72 Identity:20/72 - (27%)
Similarity:38/72 - (52%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIM 140
            ||..:.....:..::..|..||::.:..:..||.||.|:|:..|.::..|....|.|.:||.::.
plant    11 FVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLD 75

  Fly   141 GQTIQVD 147
            |::|.|:
plant    76 GRSITVN 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/3 (67%)
RRM_RBM8 67..154 CDD:409762 20/72 (28%)
GRP7NP_179760.1 RRM2_NsCP33_like 9..84 CDD:410187 20/72 (28%)

Return to query results.
Submit another query.