DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and Snrnp35

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_083808.1 Gene:Snrnp35 / 76167 MGIID:1923417 Length:244 Species:Mus musculus


Alignment Length:86 Identity:30/86 - (34%)
Similarity:48/86 - (55%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PQRSVEG---WILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQA 127
            |.:.|.|   ..|||..::.:.:|::::|.|..||:|:.:.|..|..||||||||.:||:..:..
Mouse    41 PNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAL 105

  Fly   128 LAAKEALNGAEIMGQTIQVDW 148
            :.|....:|..|....|.||:
Mouse   106 MKAYRDADGLVIDQHEIFVDY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 6/16 (38%)
RRM_RBM8 67..154 CDD:409762 29/85 (34%)
Snrnp35NP_083808.1 RRM_snRNP35 47..137 CDD:409683 28/80 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..244
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.