DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and TIA1

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_071505.2 Gene:TIA1 / 7072 HGNCID:11802 Length:386 Species:Homo sapiens


Alignment Length:85 Identity:28/85 - (32%)
Similarity:44/85 - (51%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |:|.::..:..|..|.:.|...|..||..:.:|  |..:..|..||:..|:.|.||..|:||.:|
Human     9 LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHAAAALAAMNGRKI 71

  Fly   140 MGQTIQVDWCFVKGPKRVKK 159
            ||:.::|:|...  |...||
Human    72 MGKEVKVNWATT--PSSQKK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 25/78 (32%)
TIA1NP_071505.2 RRM1_TIA1 8..81 CDD:410027 24/73 (33%)
RRM2_TIA1 104..181 CDD:410030
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..386
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.