DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and CG34354

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:112 Identity:28/112 - (25%)
Similarity:55/112 - (49%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HSYERVRNEDDDELEPGPQRSV------EGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLD 107
            ||.::.:.:...:.:...|:.|      |.:.:||..:..|.:..::::.|..:|||.:..:..|
  Fly    66 HSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRD 130

  Fly   108 RRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP 154
            .:|..||||..|.:....:|..|..|:||..:..::|:.:|...|.|
  Fly   131 PQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 7/36 (19%)
RRM_RBM8 67..154 CDD:409762 25/92 (27%)
CG34354NP_001097953.2 PABP-1234 <90..420 CDD:130689 24/88 (27%)
RRM2_TIA1_like 97..171 CDD:409789 20/73 (27%)
RRM3_TIA1_like 202..276 CDD:409790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.