DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBM23

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001339693.1 Gene:RBM23 / 55147 HGNCID:20155 Length:483 Species:Homo sapiens


Alignment Length:82 Identity:31/82 - (37%)
Similarity:44/82 - (53%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALA 129
            ||.|      |:|.|:|....||.::..|..:|:|.||.|..|..||.||||..:.:...:.|..
Human   305 GPMR------LYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARR 363

  Fly   130 AKEALNGAEIMGQTIQV 146
            |.|.|||.|:.|:.::|
Human   364 ALEQLNGFELAGRPMRV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 5/14 (36%)
RRM_RBM8 67..154 CDD:409762 29/80 (36%)
RBM23NP_001339693.1 SF-CC1 143..482 CDD:273721 31/82 (38%)

Return to query results.
Submit another query.