DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBM28

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens


Alignment Length:186 Identity:42/186 - (22%)
Similarity:79/186 - (42%) Gaps:51/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DIDNAEE---FEVDEDGDQGI-------VRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDD 60
            |.|:.||   |:.:::.::.|       |:::::|..|......||       ||.|....|:.|
Human   237 DDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSD-------HSEEDSDLEESD 294

  Fly    61 ELEPG----------------------------PQRSVEGWILFVTSIHEEAQEDEIQEKFCDYG 97
            .::.|                            |....||..:|:.::..:::|:|:.|....:|
Human   295 SIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEELGELLQQFG 359

  Fly    98 EIKNIHLNLDRRTGFSKGYALVEYETHKQA----LAA--KEALNGAEIMGQTIQVD 147
            |:|.:.:.|...|..|||.|..::.|.:.|    |||  :....|.::.|:.::||
Human   360 ELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 19/107 (18%)
RRM_RBM8 67..154 CDD:409762 24/87 (28%)
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:409847
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105
RRM2_RBM28_like 115..190 CDD:409848
PABP-1234 126..721 CDD:130689 42/186 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330 18/99 (18%)
RRM3_RBM28_like 335..417 CDD:409849 22/81 (27%)
RRM4_RBM28_like 487..581 CDD:409850
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.