DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and cirbp

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:91 Identity:27/91 - (29%)
Similarity:47/91 - (51%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||..::.|..|:.:::.|..||::..:.:..||.:..|:|:..|.:|..:.|..|..|:||..:
 Frog     8 LFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSV 72

  Fly   140 MGQTIQVDWCFVKGPKRVKKSEKRRR 165
            .|:.|:||        :..||...||
 Frog    73 DGRQIRVD--------QAGKSSNDRR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 23/78 (29%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 23/84 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 10/31 (32%)

Return to query results.
Submit another query.