DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and rnps1

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001015956.1 Gene:rnps1 / 548710 XenbaseID:XB-GENE-941526 Length:284 Species:Xenopus tropicalis


Alignment Length:133 Identity:41/133 - (30%)
Similarity:58/133 - (43%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GSDSNTREAIHSYERVRNEDD----DELE-----PGPQRSVEGWILFVTSIH-----EEAQEDEI 89
            ||.|.:|....:..|.|::..    ||.|     |.|:         .|.:|     ....:|.|
 Frog   100 GSPSPSRRRHDNRRRSRSKSKQPKRDEKERKRRSPSPR---------PTKVHIGRLTRNVTKDHI 155

  Fly    90 QEKFCDYGEIKNIHLNLDR-RTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG 153
            .|.|..||:||.|.:.:|| ....|||||.||:|..::|..|.:.::|.:|.||.|.........
 Frog   156 LEIFSTYGKIKMIDMPVDRYHPHLSKGYAYVEFEAPEEAEKALKHMDGGQIDGQEITASAVLTPW 220

  Fly   154 PKR 156
            |.|
 Frog   221 PMR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 12/49 (24%)
RRM_RBM8 67..154 CDD:409762 28/92 (30%)
rnps1NP_001015956.1 RRM_RNPS1 141..214 CDD:409800 27/72 (38%)

Return to query results.
Submit another query.