DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBMX2

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_057108.2 Gene:RBMX2 / 51634 HGNCID:24282 Length:322 Species:Homo sapiens


Alignment Length:90 Identity:35/90 - (38%)
Similarity:51/90 - (56%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 WILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGA 137
            || |:..:..|..|.:|...|..||||.||:|..|::||.|||:..:.||..:..:.|.:..||.
Human    37 WI-FLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGI 100

  Fly   138 EIMGQTIQVDWCFVKGPKRVKKSEK 162
            :|.|:||:||  .|...:..|.||:
Human   101 KIKGRTIRVD--HVSNYRAPKDSEE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/6 (50%)
RRM_RBM8 67..154 CDD:409762 32/80 (40%)
RBMX2NP_057108.2 RRM_ist3_like 27..115 CDD:409845 32/80 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..322
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.