DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and NCL

DIOPT Version :9

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_005372.2 Gene:NCL / 4691 HGNCID:7667 Length:710 Species:Homo sapiens


Alignment Length:147 Identity:46/147 - (31%)
Similarity:72/147 - (48%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EKA--------KHRKGRG-----FGSDSNTREAIHSYERVRNEDDD---ELEPGPQ-----RSVE 71
            |||        ::.|.:|     |.|..:.:||::|..:...|...   ||: ||:     ||..
Human   507 EKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQ-GPRGSPNARSQP 570

  Fly    72 GWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNG 136
            ...|||..:.|:..|:.::|.|  .|.:: ..:..||.||.|||:..|::.:.:.|.|||||:..
Human   571 SKTLFVKGLSEDTTEETLKESF--DGSVR-ARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMED 632

  Fly   137 AEIMGQTIQVDWCFVKG 153
            .||.|..:.:||...||
Human   633 GEIDGNKVTLDWAKPKG 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:413028 20/72 (28%)
RRM_RBM8 67..154 CDD:409762 31/92 (34%)
NCLNP_005372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..303
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 307..381 CDD:240849
RRM 379..628 CDD:223796 36/124 (29%)
RRM2_NCL 390..465 CDD:240850
RRM3_NCL 485..557 CDD:240851 11/49 (22%)
RRM4_NCL 572..649 CDD:240852 27/79 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..710 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.