DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and CG6937

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster


Alignment Length:71 Identity:22/71 - (30%)
Similarity:37/71 - (52%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALA 129
            ||:|.|    :.|..:.....|.::::.|..:|.:..:.|....|||.|||||.||:|..:.|..
  Fly    47 GPERGV----VIVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEVAKV 107

  Fly   130 AKEALN 135
            |.:.::
  Fly   108 AADTMD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 5/14 (36%)
RRM_RBM8 67..154 CDD:409762 20/69 (29%)
CG6937NP_651066.2 RRM_NIFK_like 52..125 CDD:409748 19/66 (29%)
RRN3 <242..>306 CDD:461623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.