DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and CstF64

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:73 Identity:29/73 - (39%)
Similarity:47/73 - (64%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            :||.:|..||.|::::|.|.:.|.:.::.|..||.:|..||:...||:..:.||:|...|||.||
  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82

  Fly   140 MGQTIQVD 147
            .|:|::||
  Fly    83 GGRTLRVD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 29/73 (40%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 29/73 (40%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.