DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and srsf7a

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:73 Identity:17/73 - (23%)
Similarity:38/73 - (52%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ::|..:...|.:.|::..|..||.::::.:..:     ..|:|.||||..:.|..|.:.::|..:
Zfish    16 VYVGDLGNGAAKGELERAFSYYGPLRSVWVARN-----PPGFAFVEYEDARDAEDAVKGMDGKVL 75

  Fly   140 MGQTIQVD 147
            .|..::|:
Zfish    76 CGARVRVE 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 1/4 (25%)
RRM_RBM8 67..154 CDD:409762 17/73 (23%)
srsf7aNP_991236.1 RRM_SF 15..91 CDD:473069 17/73 (23%)
zf-CCHC 106..121 CDD:395050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.