DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and rbm7

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:88 Identity:21/88 - (23%)
Similarity:38/88 - (43%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||.::..:..|:.|.|.|...|.:..:.:..:.. |.||.:|.|.::.......|...|||..:
Zfish    11 LFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNNE-GKSKLFAFVNFKHEVSVPYALNLLNGIRL 74

  Fly   140 MGQTIQVDWCFVKGPKRVKKSEK 162
            .|:.:.:.  |..|...:.:..|
Zfish    75 HGRQLNIK--FKTGSSHINQEGK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 19/78 (24%)
rbm7NP_956219.1 RRM_RBM7 8..82 CDD:410005 18/71 (25%)
PABP-1234 <11..195 CDD:130689 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137 1/8 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252
PRK12678 <171..>248 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.