DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and tia1l

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_956476.1 Gene:tia1l / 323447 ZFINID:ZDB-GENE-030131-2167 Length:342 Species:Danio rerio


Alignment Length:83 Identity:24/83 - (28%)
Similarity:42/83 - (50%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            :||..:..|...|:::..|..:|:|.:..:..|..||.||||..:.:.....|.:|.:.:||..:
Zfish    99 VFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWL 163

  Fly   140 MGQTIQVDWCFVK--GPK 155
            .|:.|:.:|...|  .||
Zfish   164 GGRQIRTNWATRKPSAPK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 22/80 (28%)
tia1lNP_956476.1 RRM_SF 10..83 CDD:473069
RRM2_TIA1_like 98..172 CDD:409789 20/72 (28%)
RRM3_TIAR 206..278 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.