DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBMX

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:73 Identity:24/73 - (32%)
Similarity:39/73 - (53%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..::.|..|..::..|..||.|..:.|..||.|..|:|:|.|.:|:...|..|...:||..:
Human    10 LFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly   140 MGQTIQVD 147
            .|:.|:|:
Human    75 DGKAIKVE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 24/73 (33%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 24/73 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 7/22 (32%)
dnaA 165..>306 CDD:455861
RBM1CTR 173..217 CDD:400429
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.