DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and SPAC23A1.09

DIOPT Version :9

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_594439.1 Gene:SPAC23A1.09 / 2541998 PomBaseID:SPAC23A1.09 Length:121 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:43/94 - (45%)
Similarity:69/94 - (73%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAA 130
            |.:||||:|:.||.:|.||.|:::::.|.|:|.:||:|||||||||:.|||||:||.|.:||..|
pombe     3 PAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIEYATLEQAQKA 67

  Fly   131 KEALNGAEIMGQTIQVDWCFVKGPKRVKK 159
            .:..| ..::.:.::||:.|::.|:|..:
pombe    68 VDEKN-LSLLDEKLEVDFAFLEPPERAPR 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:413028 8/13 (62%)
RRM_RBM8 67..154 CDD:409762 40/86 (47%)
SPAC23A1.09NP_594439.1 RRM <1..>118 CDD:223796 43/94 (46%)
RRM_RBM8 4..90 CDD:240770 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I2456
eggNOG 1 0.900 - - E1_KOG0130
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1669
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004710
OrthoInspector 1 1.000 - - oto101111
orthoMCL 1 0.900 - - OOG6_102283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1829
SonicParanoid 1 1.000 - - X3311
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.