DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBM34

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:95 Identity:31/95 - (32%)
Similarity:50/95 - (52%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYA 117
            |:|.:...|.....:|||     ||.::..:.:|..|::.|.|.|.|..:.:..|:.||..||:.
Human   272 RIRVDLASETSSRDKRSV-----FVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFG 331

  Fly   118 LVEYE-THKQALAAKEALNGAEIMGQTIQV 146
            .|.:| |....||.|  ||.:|:||:.::|
Human   332 YVLFENTDSVHLALK--LNNSELMGRKLRV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 8/26 (31%)
RRM_RBM8 67..154 CDD:409762 28/81 (35%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM1_RBM34 185..276 CDD:409828 2/3 (67%)
RRM2_RBM34 288..360 CDD:409829 27/79 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.