DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBMXL3

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens


Alignment Length:72 Identity:24/72 - (33%)
Similarity:40/72 - (55%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            ||:..::.:..|..::.:|..||.|..:.|..||:|..|:|:|.|.:|:...|.||...:||..:
Human    10 LFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYL 74

  Fly   140 MGQTIQV 146
            .|:.|.|
Human    75 DGKAIMV 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 24/72 (33%)
RBMXL3NP_001138818.1 RRM_RBMX_like 7..86 CDD:409816 24/72 (33%)
PABP-1234 <10..206 CDD:130689 24/72 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.