DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and Rox8

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_312633.5 Gene:Rox8 / 1273632 VectorBaseID:AGAMI1_005831 Length:458 Species:Anopheles gambiae


Alignment Length:80 Identity:24/80 - (30%)
Similarity:41/80 - (51%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            :||..:..|...:.::|.|..:|||.|..:..|.:|..|:|||.|.:....:|..|...:||..:
Mosquito    98 IFVGDLSPEIDTETLREAFAPFGEISNCRIVRDPQTLKSRGYAFVSFVKKAEAENAIAMMNGQWL 162

  Fly   140 MGQTIQVDWCFVKGP 154
            ..::|:.:|...|.|
Mosquito   163 GSRSIRTNWSTRKPP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 2/4 (50%)
RRM_RBM8 67..154 CDD:409762 23/78 (29%)
Rox8XP_312633.5 PABP-1234 9..>269 CDD:130689 24/80 (30%)
RRM2_TIA1_like 97..171 CDD:409789 21/72 (29%)

Return to query results.
Submit another query.