DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and eIF3g1

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_308202.3 Gene:eIF3g1 / 1269559 VectorBaseID:AGAMI1_005021 Length:271 Species:Anopheles gambiae


Alignment Length:79 Identity:21/79 - (26%)
Similarity:40/79 - (50%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMG 141
            ::::.|...|.:::|....:|....:.|:.|:.||..||:|.|.:.:.:.|..|.|.|||.....
Mosquito   193 ISNLSEAMTEADLEELVKKFGPHTKMFLSRDKSTGLCKGFAYVHFRSRRDAATAIEVLNGYGYDH 257

  Fly   142 QTIQVDWCFVKGPK 155
            ..:.|:|...:.|:
Mosquito   258 LILSVEWSKPQNPQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 0/2 (0%)
RRM_RBM8 67..154 CDD:409762 20/76 (26%)
eIF3g1XP_308202.3 eIF3g 25..138 CDD:463545
RRM_eIF3G_like 191..265 CDD:409842 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.