DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and CIRBP

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:91 Identity:28/91 - (30%)
Similarity:45/91 - (49%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||..:..:..|..:::.|..||:|..:.:..||.|..|:|:..|.:|....|..|..|:||..:
Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72

  Fly   140 MGQTIQVDWCFVKGPKRVKKSEKRRR 165
            .|:.|:||       :..|.|:.|.|
Human    73 DGRQIRVD-------QAGKSSDNRSR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 24/78 (31%)
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 24/83 (29%)

Return to query results.
Submit another query.