DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2a and AT5G17530

DIOPT Version :9

Sequence 1:NP_610453.1 Gene:Pgm2a / 35923 FlyBaseID:FBgn0033377 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001332304.1 Gene:AT5G17530 / 831619 AraportID:AT5G17530 Length:638 Species:Arabidopsis thaliana


Alignment Length:334 Identity:78/334 - (23%)
Similarity:123/334 - (36%) Gaps:97/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VMVTASHNPKEDNGYKVYWTNGAQIIPPHDEGIQESILNNLEPKGSSWDDSAMCSNTMLEDPYDI 229
            :|:||||.|...||:|.:.::|         |:.:..:.|:                 ||...||
plant   201 IMITASHLPYNRNGFKFFTSDG---------GLGKVDIKNI-----------------LERAADI 239

  Fly   230 VVPPYFDILKKQLPCTSLEANGRCSLSFT-------YTAMHGV----------------GYAFVK 271
            .         |:|...:|..:.|.|.|.|       ||:  |:                |:..|.
plant   240 Y---------KKLSDENLRKSQRESSSITKVDYMSVYTS--GLVKAVRKAAGDLEKPLEGFHIVV 293

  Fly   272 QA-------FARINLKPFISVCEQQ---EPDPEFPTTPMPNPEEGKTSLDLSIKTAKANSSQIIL 326
            .|       ||...|:|..::....   |||..|| ..:||||: |.:::...|....|.:.:.:
plant   294 DAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFP-NHIPNPED-KAAMEAITKAVLDNKADLGI 356

  Fly   327 ANDPDADRLAVAEVREDGSYKLFSGNEVGALLGWWSLELHKMREPDCDVSNCVMIASTVSSKILR 391
            ..|.|.||.|..    |.|.:.|:.|.:.|||....||.|         ....::..:|:|..|.
plant   357 IFDTDVDRSAAV----DSSGREFNRNRLIALLSAIVLEEH---------PGTTIVTDSVTSDGLT 408

  Fly   392 AMAERE-GFQFFETLTGFKWMGNKAIELQQAGKTVLFAFEEAIGFMVGTTVLDKDGVSAAGHLAT 455
            :..|:: |.:......|:|.:.::||.|...|:....|.|.:           ..|.....|...
plant   409 SFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETS-----------GHGALKENHWLD 462

  Fly   456 MACYLRCKL 464
            ...||..|:
plant   463 DGAYLMVKI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2aNP_610453.1 PTZ00150 23..623 CDD:240294 78/334 (23%)
PGM2 62..604 CDD:100092 78/334 (23%)
AT5G17530NP_001332304.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1109
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1041556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.