DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2a and prtfdc1a

DIOPT Version :9

Sequence 1:NP_610453.1 Gene:Pgm2a / 35923 FlyBaseID:FBgn0033377 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_002666638.2 Gene:prtfdc1a / 100334391 ZFINID:ZDB-GENE-120727-16 Length:225 Species:Danio rerio


Alignment Length:139 Identity:31/139 - (22%)
Similarity:52/139 - (37%) Gaps:35/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 DIYETYGFHTTVSSYVICRCPPVIEQIFERLRTWDEGKADTYPTSILNGEYEIENVRDLTTGFDS 538
            |:...|..|..:.:.:.|....::|.|         |..|.....:|.|.|:.  ..||.....:
Zfish    38 DLECVYIPHGVIMNRIECLARDILEDI---------GHHDMMVLCVLKGGYKF--CSDLVESIKA 91

  Fly   539 STGDKKATLPTSSSSQMIT----FTFKNGLVVTLRTSGTEPKMKYYAEMCGKPDEKNWAKLTNTM 599
            .:        .|::|::.|    ..||:    .|....||.     ..:.| ||:.:..|..|.:
Zfish    92 QS--------RSTNSRLTTRVEFIRFKS----YLNDQSTED-----LHIIG-PDDLSMLKGKNVL 138

  Fly   600 NTMVEAIVE 608
              :|||||:
Zfish   139 --IVEAIVD 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2aNP_610453.1 PTZ00150 23..623 CDD:240294 31/139 (22%)
PGM2 62..604 CDD:100092 26/133 (20%)
prtfdc1aXP_002666638.2 PRTases_typeI 10..224 CDD:294217 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.