DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8078 and Y71H2B.5

DIOPT Version :9

Sequence 1:NP_610451.1 Gene:CG8078 / 35920 FlyBaseID:FBgn0033375 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_497589.3 Gene:Y71H2B.5 / 175380 WormBaseID:WBGene00022195 Length:957 Species:Caenorhabditis elegans


Alignment Length:229 Identity:63/229 - (27%)
Similarity:98/229 - (42%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ISSSNLFRRGEKVAVAASGGKDSTVLAHVLKLLNERHN----YGLELVLLSIDEGITGYRDDSL- 100
            |....:.|.|:||.|..||||||..|.|:|:...:|.|    ...||..:::|.|...|....| 
 Worm   710 IHQLKMIRDGDKVLVCLSGGKDSLSLLHILRHYQQRCNKARSTSFELGAITVDPGSAEYNPRPLI 774

  Fly   101 ETVKQNRDDYQMPLKILSYEELYGWTMDRIVA---QIGRSNNCTFCGVFRRQALDRGAKLLGVDS 162
            |..::...||       .|||     .|.|.|   ..|..:.|.||...:|..|...|:|.|.:.
 Worm   775 EYCRRLNIDY-------FYEE-----QDIIGAARKTPGLRSICAFCSRMKRGRLAAAAQLHGWNV 827

  Fly   163 IATGHNADDIAETVLMNVLR-GDTARLRRCTSIRTGGGEDTIPRVKPLKYSYEKEIVMYAHYKKL 226
            :|.|.:.||:||:..:...: |:.:.::...:.:.|    .:..::||....||.:..:|..|||
 Worm   828 LAMGQHLDDLAESFFIAAFQNGNLSTMKAQYTTKDG----ALRVIRPLVMVREKALRNFAEDKKL 888

  Fly   227 VYFSTEC--VFAPNAYRGHARAFLKDLEKVRPSV 258
            ...:..|  .|.....|...:..|...|.:.|.:
 Worm   889 PVVAENCPACFNQATERHRVKQLLAQQELIFPDL 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8078NP_610451.1 TilS 28..311 CDD:223115 63/229 (28%)
Alpha_ANH_like_II 52..239 CDD:238951 56/197 (28%)
TIGR00269 203..304 CDD:129370 14/58 (24%)
Y71H2B.5NP_497589.3 CsdA 56..493 CDD:223594
AAT_I 75..487 CDD:302748
Alpha_ANH_like_II 721..901 CDD:238951 56/195 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.