DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbp45A and Dbp21E2

DIOPT Version :9

Sequence 1:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_608544.1 Gene:Dbp21E2 / 33254 FlyBaseID:FBgn0086130 Length:536 Species:Drosophila melanogaster


Alignment Length:395 Identity:107/395 - (27%)
Similarity:183/395 - (46%) Gaps:54/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRPWLVKQL-TKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPV--- 74
            :.|.|::.| .:||:|..|.||::.:|.:...:.|:.||:||.|||..:.|||:::|.::.|   
  Fly   115 IHPQLLENLRVELGIKLLTGIQKQGMPVVHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVVTE 179

  Fly    75 ----SHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQRPH-----IVV 130
                :...|:|||..|||.||:.......|...::|..:.||     .:::||..|.     |:|
  Fly   180 RKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQSLLGG-----NTKQLMMNPQFEEVDILV 239

  Fly   131 AMPGRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERCLP--------KTRQNLFF 187
            |..|.|:..:| ...:..:.:::||:||||.:|:..|.:.||...|..|        ...|.:..
  Fly   240 ATLGALSKLVT-TGIYRMEQVRHLVLDEADTLLDDTFTDKLSYFLRRFPFHLVQKEDAGTQMILA 303

  Fly   188 SATMKDFIKESSIFPIASDCFEWSQDSDVATVET------------LDQRYLLCADYDRDMVLIE 240
            ||||....:|.....|           ||.|:..            :.|::|..:..||...|:.
  Fly   304 SATMPTNTREILHKVI-----------DVDTIREVVSPHLHRLMSHVTQKFLRLSKADRPATLLS 357

  Fly   241 ALRKYREENENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTL 305
            .::  .:..:...:::|:|.......:|:.|.|..::.:.|:|.|..|.|:....:|::.....|
  Fly   358 LVK--HDLAKRRPLIVFSNKSTTSDFVSIFLNNSGVNCLNLNGDMLMKIRLGRFEQFQNGHCDVL 420

  Fly   306 IATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGR--KGMSISIFRFPRDLELLAAIE 368
            ..|||.:||||......|:|...|....:||||.||..|.|.  |.:..::....|:::::..||
  Fly   421 STTDVGSRGLDTTRARHVVNFDFPLHVSDYIHRCGRIGRVGNMDKALVTNLISSRREIDVVQRIE 485

  Fly   369 EEINT 373
            ....|
  Fly   486 HAART 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 107/395 (27%)
DEADc 9..197 CDD:238167 62/203 (31%)
Helicase_C 239..346 CDD:278689 29/106 (27%)
Dbp21E2NP_608544.1 P-loop_NTPase 113..314 CDD:304359 62/204 (30%)
DEXDc 126..330 CDD:214692 64/220 (29%)
HELICc 343..462 CDD:238034 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.