Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371879.1 | Gene: | NLRC5 / 84166 | HGNCID: | 29933 | Length: | 1866 | Species: | Homo sapiens |
Alignment Length: | 428 | Identity: | 101/428 - (23%) |
---|---|---|---|
Similarity: | 160/428 - (37%) | Gaps: | 117/428 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LLPCEYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQFKRLTFEERIGRRYHCI--RDL 67
Fly 68 RIIVNYLLRRP----QLSVQ---------ISSLVVSNWDAGLLKDFVRSLLPVWYIELRL---MR 116
Fly 117 FPRE----FFVMLRLNAAKM----------------NVSQLSLEGTPLTDED--VRILREFLLVS 159
Fly 160 ----KTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQ 220
Fly 221 NTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDL 285
Fly 286 SYCSIG----------------------------THGGEWVAKYLASCRRLQVLHLNYNDMG-PT 321
Fly 322 AVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLD 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 10/32 (31%) |
LRR_RI | 137..374 | CDD:238064 | 68/258 (26%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 3/17 (18%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 13/54 (24%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 10/27 (37%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 5/20 (25%) | ||
NLRC5 | NP_001371879.1 | Atypical_Card | 1..95 | CDD:408254 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 105..135 | ||||
NACHT | 222..383 | CDD:399032 | |||
NLRC4_HD2 | 514..628 | CDD:407648 | |||
LRR 1 | 599..622 | ||||
LRR_RI | 690..1069 | CDD:423007 | |||
LRR 2 | 713..737 | ||||
leucine-rich repeat | 716..743 | CDD:275380 | |||
LRR 3 | 741..765 | ||||
leucine-rich repeat | 744..771 | CDD:275380 | |||
LRR 4 | 769..792 | ||||
leucine-rich repeat | 772..799 | CDD:275380 | |||
leucine-rich repeat | 800..826 | CDD:275380 | |||
leucine-rich repeat | 830..871 | CDD:275380 | |||
LRR 5 | 869..892 | ||||
leucine-rich repeat | 872..899 | CDD:275380 | |||
LRR 6 | 897..921 | ||||
LRR 7 | 930..953 | ||||
LRR 8 | 976..1000 | ||||
LRR 9 | 1004..1026 | ||||
LRR_RI | 1009..1307 | CDD:423007 | |||
LRR 10 | 1031..1058 | ||||
LRR 11 | 1138..1161 | ||||
LRR 12 | 1162..1184 | ||||
LRR 13 | 1242..1265 | ||||
LRR 14 | 1272..1294 | ||||
LRR 15 | 1462..1488 | 7/25 (28%) | |||
leucine-rich repeat | 1465..1495 | CDD:275381 | 10/29 (34%) | ||
LRR 16 | 1493..1516 | 8/25 (32%) | |||
leucine-rich repeat | 1496..1523 | CDD:275381 | 10/29 (34%) | ||
LRR 17 | 1521..1544 | 3/27 (11%) | |||
LRR_RI | 1522..1822 | CDD:423007 | 49/201 (24%) | ||
leucine-rich repeat | 1524..1545 | CDD:275380 | 3/25 (12%) | ||
leucine-rich repeat | 1546..1579 | CDD:275380 | 7/32 (22%) | ||
LRR 18 | 1554..1577 | 5/22 (23%) | |||
LRR 19 | 1578..1600 | 7/22 (32%) | |||
leucine-rich repeat | 1580..1607 | CDD:275380 | 7/26 (27%) | ||
LRR 20 | 1605..1628 | 8/22 (36%) | |||
leucine-rich repeat | 1608..1635 | CDD:275380 | 8/26 (31%) | ||
LRR 21 | 1633..1656 | 2/22 (9%) | |||
leucine-rich repeat | 1636..1663 | CDD:275380 | 5/26 (19%) | ||
LRR 22 | 1661..1684 | 12/25 (48%) | |||
leucine-rich repeat | 1664..1688 | CDD:275380 | 10/26 (38%) | ||
LRR 23 | 1687..1714 | 7/27 (26%) | |||
leucine-rich repeat | 1690..1717 | CDD:275380 | 7/24 (29%) | ||
LRR 24 | 1715..1739 | ||||
leucine-rich repeat | 1718..1741 | CDD:275380 | |||
LRR 25 | 1741..1762 | ||||
leucine-rich repeat | 1742..1769 | CDD:275380 | |||
leucine-rich repeat | 1770..1789 | CDD:275380 | |||
LRR 26 | 1795..1818 | ||||
leucine-rich repeat | 1798..1825 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |