DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and CEP78

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001092272.1 Gene:CEP78 / 84131 HGNCID:25740 Length:722 Species:Homo sapiens


Alignment Length:238 Identity:55/238 - (23%)
Similarity:99/238 - (41%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 W--DAGL-LKDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVS----QLSLEGTPLTDEDV 149
            |  |.|. :..|.||.:|.       :|:....|.:.:.....:::|    .|.|.|..|.:.|:
Human    80 WLGDTGSDMNKFCRSRVPA-------IRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDL 137

  Fly   150 RILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLD-TEKISSV 213
            .||.:.|..|.:|..|::::|.:......:|..|:..|..::.::   ..|.:|:.. .:.::.:
Human   138 TILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVN---FTGCNLTWQGADHMAKI 199

  Fly   214 LSSLLMQ--NTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNK-IGPDGAFFLLRGMS 275
            |....|:  ...||.||.:..       |..:.:|    ..||:.:.||. ||..||......:|
Human   200 LKYQTMRRHEETWAESLRYRR-------PDLDCMA----GLRRITLNCNTLIGDLGACAFADSLS 253

  Fly   276 MGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDM 318
            ....|..|||..|.:...|.:.:.:.|.:...|.||.:..|.:
Human   254 EDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 10/30 (33%)
LRR_RI 137..374 CDD:238064 45/186 (24%)
leucine-rich repeat 162..189 CDD:275381 6/26 (23%)
leucine-rich repeat 202..220 CDD:275380 2/18 (11%)
leucine-rich repeat 223..251 CDD:275380 6/27 (22%)
leucine-rich repeat 252..279 CDD:275380 9/27 (33%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 4/11 (36%)
leucine-rich repeat 336..357 CDD:275380
CEP78NP_001092272.1 LRR_RI <108..294 CDD:238064 45/199 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.