DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Nlrp4c

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_113566.2 Gene:Nlrp4c / 83564 MGIID:1890518 Length:982 Species:Mus musculus


Alignment Length:405 Identity:94/405 - (23%)
Similarity:163/405 - (40%) Gaps:56/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQRE----YDKRPYRQFQFKRLTFEERIGRRYH 62
            |..|.....:.:...|...|.|  :|..||.||...    ...:.....|.|.....|...    
Mouse   594 CSTLKKLSLSTQNVLSEGQEHS--YTEKLLMCWHHMCSVLISSKDIYILQVKNTNLNETAS---- 652

  Fly    63 CIRDLRIIVNYLLRRPQLSVQISSLVVSN----WDAGLLKDFVRSLLPVWYIELRLMRFPREFFV 123
                 .::.::|:   ..|..:.:|||:|    .|..|..:.:::.. :.:::|.|.........
Mouse   653 -----LVLYSHLM---YPSCTLKALVVNNVTFLCDNRLFFELIQNQC-LQHLDLNLTFLSHGDVK 708

  Fly   124 ML--RLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQ------------ 174
            :|  .|:..:.|:.:|.:....|:.:|.::....|:.||.|:.||:||.:|.:            
Mouse   709 LLCDVLSQEECNIEKLMVAACNLSPDDCKVFASVLISSKMLKHLNLSSNNLDKGISSLSKALCHP 773

  Fly   175 ----FNFALIADGV------YKSPGVRR-LSANRLLGMSLSLDTEKISSVLSSL-LMQNTLWALS 227
                .|..|:...:      |.|..:|| .:.|.|...|..|..|.:..:..:| |..:.|.:||
Mouse   774 DCVLKNLVLVNCSLSEQCWDYLSEVLRRNKTLNHLDISSNDLKDEGLKVLCGALSLPDSVLKSLS 838

  Fly   228 LEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIG 291
            :.:|.:|......:||.| |.|...|.|:::.|||...|...|...:.... :||.:.|..|::.
Mouse   839 VRYCLITTSGCQDLAEVL-RKNQNLRNLQVSNNKIEDAGVKLLCDAIKHPNCHLENIGLEACALT 902

  Fly   292 THGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMK-KQCKLEKLTLYGNHFDSRTAMIVR 355
            ....|.:|.....|:.|..::|..|.:..:.:.::..|:| :||.|..|.|....||..|    :
Mouse   903 GACCEDLASAFTHCKTLWGINLQENALDHSGLIVLFEALKQQQCTLHVLGLRITDFDKET----Q 963

  Fly   356 RLLDAEVVLHSELDI 370
            .||.||...:..|.|
Mouse   964 ELLMAEEEKNPHLSI 978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 68/260 (26%)
leucine-rich repeat 162..189 CDD:275381 10/48 (21%)
leucine-rich repeat 202..220 CDD:275380 5/18 (28%)
leucine-rich repeat 223..251 CDD:275380 10/27 (37%)
leucine-rich repeat 252..279 CDD:275380 7/27 (26%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 6/27 (22%)
leucine-rich repeat 336..357 CDD:275380 6/20 (30%)
Nlrp4cNP_113566.2 Pyrin_NALPs 10..92 CDD:260032
NACHT 148..317 CDD:283404
LRR 1 594..617 5/24 (21%)
LRR_RI 689..953 CDD:238064 63/265 (24%)
LRR 2 689..716 4/27 (15%)
leucine-rich repeat 692..720 CDD:275380 4/27 (15%)
leucine-rich repeat 721..739 CDD:275380 3/17 (18%)
LRR 742..>960 CDD:227223 57/218 (26%)
LRR 3 746..773 8/26 (31%)
leucine-rich repeat 749..776 CDD:275380 6/26 (23%)
leucine-rich repeat 777..804 CDD:275380 6/26 (23%)
LRR 4 802..825 5/22 (23%)
leucine-rich repeat 805..832 CDD:275380 7/26 (27%)
LRR 5 827..844 6/16 (38%)
leucine-rich repeat 834..861 CDD:275380 10/27 (37%)
LRR 6 859..882 8/22 (36%)
leucine-rich repeat 862..890 CDD:275380 7/27 (26%)
leucine-rich repeat 891..918 CDD:275380 7/26 (27%)
LRR 7 916..940 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.