DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and LRRC31

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_079003.2 Gene:LRRC31 / 79782 HGNCID:26261 Length:552 Species:Homo sapiens


Alignment Length:401 Identity:85/401 - (21%)
Similarity:147/401 - (36%) Gaps:134/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 WQREYDKRPYRQFQFKRLTFEERIGRR--YHCI---------RDLRIIVNYLLRRPQLSVQISSL 87
            |:...:|..:         |.:::|::  ..|:         .|::.:|..|...|.|    ..|
Human    68 WRSSMEKNEH---------FLQKLGKKAVNKCLDLNNCGLTTADMKEMVALLPFLPDL----EEL 119

  Fly    88 VVSNWDAGLLKDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRIL 152
            .:| |: |.:...:.|:....::..:|.        :|||.:.:            ||.:||:.|
Human   120 DIS-WN-GFVGGTLLSITQQMHLVSKLK--------ILRLGSCR------------LTTDDVQAL 162

  Fly   153 REFLLVSKTLRRLNVS----------------------------SCSLTQFNFALIADGVYKSPG 189
            .|...:...|..||:|                            .||||.      .||.:....
Human   163 GEAFEMIPELEELNLSWNSKVGGNLPLILQKFQKGSKIQMIELVDCSLTS------EDGTFLGQL 221

  Fly   190 VRRLSANRLLGMSLSLD-TEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFR 253
            :..|.:..:|.:|::.| ...::|:...|...:.|..|.|..|.| :|..:.|.:...|...:.|
Human   222 LPMLQSLEVLDLSINRDIVGSLNSIAQGLKSTSNLKVLKLHSCGL-SQKSVKILDAAFRYLGELR 285

  Fly   254 RLRIACNKIGPDGAFFLLRGMSMGG-------------NLELLDLSYCSIGTHGGEWVAKYLASC 305
            :|.::|||             .:||             :|::|||..||:.......:.:.:...
Human   286 KLDLSCNK-------------DLGGGFEDSPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLL 337

  Fly   306 RRLQVLHLNYN-DMGPTAVNLI-----LLAMK----KQCKLEKLTLYGNHFDSRTAMIVRRLLDA 360
            ..||.|.|:.| .||.::.||:     |.|:|    ..|.||..|.        ||:       |
Human   338 SNLQELDLSANKKMGSSSENLLSRLRFLPALKSLVINNCALESETF--------TAL-------A 387

  Fly   361 EVVLH-SELDI 370
            |..:| |.|::
Human   388 EASVHLSALEV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 6/26 (23%)
LRR_RI 137..374 CDD:238064 66/287 (23%)
leucine-rich repeat 162..189 CDD:275381 10/54 (19%)
leucine-rich repeat 202..220 CDD:275380 4/18 (22%)
leucine-rich repeat 223..251 CDD:275380 8/27 (30%)
leucine-rich repeat 252..279 CDD:275380 7/39 (18%)
leucine-rich repeat 280..307 CDD:275380 6/26 (23%)
leucine-rich repeat 308..335 CDD:275380 12/36 (33%)
leucine-rich repeat 336..357 CDD:275380 5/20 (25%)
LRRC31NP_079003.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65
LRR_RI 91..349 CDD:330982 61/303 (20%)
leucine-rich repeat 91..115 CDD:275380 3/23 (13%)
leucine-rich repeat 116..143 CDD:275380 6/32 (19%)
leucine-rich repeat 144..171 CDD:275380 10/46 (22%)
leucine-rich repeat 172..227 CDD:275380 11/60 (18%)
LRR 1 227..246 3/18 (17%)
leucine-rich repeat 228..255 CDD:275380 5/26 (19%)
LRR_RI 233..>498 CDD:330982 48/195 (25%)
LRR 2 255..275 7/20 (35%)
leucine-rich repeat 256..283 CDD:275380 8/27 (30%)
LRR 3 283..293 3/9 (33%)
leucine-rich repeat 284..311 CDD:275380 7/39 (18%)
LRR 4 311..331 6/19 (32%)
leucine-rich repeat 312..339 CDD:275380 6/26 (23%)
LRR 5 339..360 9/20 (45%)
leucine-rich repeat 340..367 CDD:275380 10/26 (38%)
LRR 6 367..387 8/34 (24%)
leucine-rich repeat 368..395 CDD:275380 10/41 (24%)
LRR 7 395..415 1/4 (25%)
LRR 8 423..443
leucine-rich repeat 424..453 CDD:275380
LRR 9 453..475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.