Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079003.2 | Gene: | LRRC31 / 79782 | HGNCID: | 26261 | Length: | 552 | Species: | Homo sapiens |
Alignment Length: | 401 | Identity: | 85/401 - (21%) |
---|---|---|---|
Similarity: | 147/401 - (36%) | Gaps: | 134/401 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 WQREYDKRPYRQFQFKRLTFEERIGRR--YHCI---------RDLRIIVNYLLRRPQLSVQISSL 87
Fly 88 VVSNWDAGLLKDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRIL 152
Fly 153 REFLLVSKTLRRLNVS----------------------------SCSLTQFNFALIADGVYKSPG 189
Fly 190 VRRLSANRLLGMSLSLD-TEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFR 253
Fly 254 RLRIACNKIGPDGAFFLLRGMSMGG-------------NLELLDLSYCSIGTHGGEWVAKYLASC 305
Fly 306 RRLQVLHLNYN-DMGPTAVNLI-----LLAMK----KQCKLEKLTLYGNHFDSRTAMIVRRLLDA 360
Fly 361 EVVLH-SELDI 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 6/26 (23%) |
LRR_RI | 137..374 | CDD:238064 | 66/287 (23%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 10/54 (19%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 4/18 (22%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 8/27 (30%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 7/39 (18%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 12/36 (33%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 5/20 (25%) | ||
LRRC31 | NP_079003.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..65 | ||
LRR_RI | 91..349 | CDD:330982 | 61/303 (20%) | ||
leucine-rich repeat | 91..115 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 116..143 | CDD:275380 | 6/32 (19%) | ||
leucine-rich repeat | 144..171 | CDD:275380 | 10/46 (22%) | ||
leucine-rich repeat | 172..227 | CDD:275380 | 11/60 (18%) | ||
LRR 1 | 227..246 | 3/18 (17%) | |||
leucine-rich repeat | 228..255 | CDD:275380 | 5/26 (19%) | ||
LRR_RI | 233..>498 | CDD:330982 | 48/195 (25%) | ||
LRR 2 | 255..275 | 7/20 (35%) | |||
leucine-rich repeat | 256..283 | CDD:275380 | 8/27 (30%) | ||
LRR 3 | 283..293 | 3/9 (33%) | |||
leucine-rich repeat | 284..311 | CDD:275380 | 7/39 (18%) | ||
LRR 4 | 311..331 | 6/19 (32%) | |||
leucine-rich repeat | 312..339 | CDD:275380 | 6/26 (23%) | ||
LRR 5 | 339..360 | 9/20 (45%) | |||
leucine-rich repeat | 340..367 | CDD:275380 | 10/26 (38%) | ||
LRR 6 | 367..387 | 8/34 (24%) | |||
leucine-rich repeat | 368..395 | CDD:275380 | 10/41 (24%) | ||
LRR 7 | 395..415 | 1/4 (25%) | |||
LRR 8 | 423..443 | ||||
leucine-rich repeat | 424..453 | CDD:275380 | |||
LRR 9 | 453..475 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |