DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and si:ch211-108d22.2

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_009297512.1 Gene:si:ch211-108d22.2 / 793004 ZFINID:ZDB-GENE-131127-97 Length:1739 Species:Danio rerio


Alignment Length:185 Identity:40/185 - (21%)
Similarity:63/185 - (34%) Gaps:64/185 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSNWDAGLLKDFVRSL-----LP-VWYIELRLMRFPREFFVMLRLNAAKMNV------------- 134
            |.|::....:.|:.:|     :| ||.|:|. .|.......:|:|.|.|..|             
Zfish  1556 VKNYETQTGRSFIPALQSVFQIPDVWIIDLS-QRKTSVLLEVLKLQAEKKPVELRGCSEEESEVK 1619

  Fly   135 ---------SQLS------------------------------LEGTPLTDEDVRILREFLLVSK 160
                     ||||                              |..|||..:..|.|...|..|:
Zfish  1620 SFLQCLPYISQLSCAKPLLLQFLTHVRREQAESLSAALGEELDLSQTPLDLQACRGLALILEYSE 1684

  Fly   161 TLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLS 215
            .|..|:::.|.||.::..|:...::|:..:     |........:..:||.||.|
Zfish  1685 GLTELDLNQCHLTDYSLDLLLPNLHKAQNI-----NFRWNYITDVGAQKIYSVFS 1734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 13/78 (17%)
LRR_RI 137..374 CDD:238064 23/109 (21%)
leucine-rich repeat 162..189 CDD:275381 7/26 (27%)
leucine-rich repeat 202..220 CDD:275380 5/14 (36%)
leucine-rich repeat 223..251 CDD:275380
leucine-rich repeat 252..279 CDD:275380
leucine-rich repeat 280..307 CDD:275380
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
si:ch211-108d22.2XP_009297512.1 CARD 12..91 CDD:260018
P-loop_NTPase 208..352 CDD:304359
LRR_RI 1575..>1738 CDD:238064 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.