Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002894.2 | Gene: | Nlrp14 / 76858 | MGIID: | 1924108 | Length: | 993 | Species: | Mus musculus |
Alignment Length: | 246 | Identity: | 65/246 - (26%) |
---|---|---|---|
Similarity: | 110/246 - (44%) | Gaps: | 42/246 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 MLRLNAAKMNVSQ----------------LSLEGTPLTDEDVRILREFL-LVSKTLRRLNVSSCS 171
Fly 172 LTQFNFALIADGVYKSPGVRRLSANRLLGMSLS---LDTEKISSVLSSLLM--QNTLWALSLEHC 231
Fly 232 ELTAQDMIPI-AEHLART---NSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIG 291
Fly 292 THGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKK-QCKLEKLTL 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 8/43 (19%) |
LRR_RI | 137..374 | CDD:238064 | 60/217 (28%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 11/31 (35%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 5/27 (19%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 2/6 (33%) | ||
Nlrp14 | NP_001002894.2 | NACHT | 82..249 | CDD:368582 | |
NOD2_WH | 326..381 | CDD:375327 | |||
NLRC4_HD2 | 383..500 | CDD:375325 | |||
LRR_RI | 635..952 | CDD:393385 | 65/246 (26%) | ||
LRR 1 | 636..657 | ||||
leucine-rich repeat | 637..660 | CDD:275380 | |||
LRR 2 | 660..680 | 5/16 (31%) | |||
leucine-rich repeat | 661..717 | CDD:275380 | 12/53 (23%) | ||
LRR 3 | 688..708 | 4/19 (21%) | |||
LRR 4 | 717..738 | 7/20 (35%) | |||
leucine-rich repeat | 718..745 | CDD:275380 | 9/34 (26%) | ||
LRR 5 | 745..765 | 7/20 (35%) | |||
leucine-rich repeat | 746..774 | CDD:275380 | 10/28 (36%) | ||
LRR 6 | 774..795 | 11/25 (44%) | |||
leucine-rich repeat | 775..802 | CDD:275380 | 11/31 (35%) | ||
LRR 7 | 802..822 | 4/19 (21%) | |||
leucine-rich repeat | 803..831 | CDD:275380 | 5/27 (19%) | ||
LRR 8 | 831..852 | 5/20 (25%) | |||
leucine-rich repeat | 832..859 | CDD:275380 | 6/26 (23%) | ||
LRR 9 | 859..879 | 5/19 (26%) | |||
leucine-rich repeat | 860..888 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 889..909 | CDD:275380 | 2/6 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000189 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |