Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083329.2 | Gene: | Lrrc74b / 74685 | MGIID: | 1921935 | Length: | 391 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 59/228 - (25%) |
---|---|---|---|
Similarity: | 95/228 - (41%) | Gaps: | 46/228 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 ALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSV--LSSLLMQNTLWALSLEHCELTAQDMIP 240
Fly 241 I------------------------AEHLA---RTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG 278
Fly 279 NLELLDLSYCSIGTHGGEWVAKYLASC----RRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKL 339
Fly 340 TLYGNHFDSRTAMIVRRLLDAEVVLHSELDISY 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | |
LRR_RI | 137..374 | CDD:238064 | 59/228 (26%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 4/10 (40%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 11/54 (20%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 4/26 (15%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 7/30 (23%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 6/20 (30%) | ||
Lrrc74b | NP_083329.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | ||
LRR_RI | 56..353 | CDD:238064 | 53/204 (26%) | ||
leucine-rich repeat | 81..106 | CDD:275380 | 5/24 (21%) | ||
LRR 1 | 106..126 | 2/19 (11%) | |||
leucine-rich repeat | 107..128 | CDD:275380 | 4/20 (20%) | ||
LRR 2 | 134..154 | 4/19 (21%) | |||
leucine-rich repeat | 159..190 | CDD:275380 | 7/34 (21%) | ||
LRR 3 | 162..182 | 5/23 (22%) | |||
LRR_8 | 189..257 | CDD:290566 | 22/67 (33%) | ||
LRR 4 | 190..211 | 6/20 (30%) | |||
leucine-rich repeat | 191..218 | CDD:275380 | 7/26 (27%) | ||
LRR 5 | 218..239 | 6/20 (30%) | |||
leucine-rich repeat | 219..243 | CDD:275380 | 8/23 (35%) | ||
LRR 6 | 246..259 | 5/10 (50%) | |||
leucine-rich repeat | 247..270 | CDD:275380 | 5/9 (56%) | ||
LRR 7 | 274..294 | ||||
leucine-rich repeat | 275..292 | CDD:275380 | |||
LRR 8 | 302..323 | ||||
leucine-rich repeat | 303..332 | CDD:275380 | |||
LRR 9 | 332..354 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 371..391 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |