DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Lrrc74a

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001182696.1 Gene:Lrrc74a / 627607 MGIID:3646959 Length:487 Species:Mus musculus


Alignment Length:415 Identity:89/415 - (21%)
Similarity:157/415 - (37%) Gaps:107/415 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQFKRLTFEE-----RIGRRYH 62
            ||.|.||  .:..||...|||.                   |:.....|..|:     .||::..
Mouse    27 DVTLYCE--AEVLPSVEKEKSA-------------------REDSETDLEIEDTEKFFNIGQKEL 70

  Fly    63 CIRDLRII----VNYLLRR--------------PQLSVQISSLVVSNWDAGLLKDFVRSLLPVWY 109
            .:...:::    .:|.:|.              |..:..|:..:|||  ..:||           
Mouse    71 YLEACKLVGVVPASYFIRNMEESCVNLNHHGLGPMGTKAIAITLVSN--TTVLK----------- 122

  Fly   110 IEL-----------RLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLV-SKTL 162
            :||           .||....|.:.:..||.:..|   |.|||       .||:..||.. :.:|
Mouse   123 LELGDNCIQEEGIMSLMEMLHENYYLQELNVSDNN---LGLEG-------ARIISNFLQENNSSL 177

  Fly   163 RRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSV----LSSLLMQNT- 222
            .:|.:|..|..:...||:...:..:..:|          ||:|...:.|.:    |..:|..|. 
Mouse   178 WKLKLSGNSFKEECAALLCQALSSNYRIR----------SLNLSHNEFSDIGGEHLGQMLALNVG 232

  Fly   223 LWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSY 287
            |.:|:|.......:..:.:...| |:|...::|.::.|..|.:||..|...:.:...|..:|:|.
Mouse   233 LQSLNLSWNHFNIRGAVALCNGL-RSNVTLKKLDVSMNGFGNEGALALGDALRLNSCLVYVDVSR 296

  Fly   288 CSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKK--QCKLEKLTLYGNHFDSRT 350
            ..|...|...::|.|.:...||||.|..|.:.......:::|:|:  :.::|.:       |...
Mouse   297 NGITNEGASKISKGLENNECLQVLKLFLNPLSLEGAYSLIMAIKRNPKSRMEDI-------DISN 354

  Fly   351 AMIVR---RLLDAEVVLHSELDISY 372
            .::..   ::||....:|.:||:.|
Mouse   355 VLVSEQFVKVLDGVCAIHPQLDVVY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 8/27 (30%)
LRR_RI 137..374 CDD:238064 57/247 (23%)
leucine-rich repeat 162..189 CDD:275381 6/26 (23%)
leucine-rich repeat 202..220 CDD:275380 6/21 (29%)
leucine-rich repeat 223..251 CDD:275380 6/27 (22%)
leucine-rich repeat 252..279 CDD:275380 6/26 (23%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 8/28 (29%)
leucine-rich repeat 336..357 CDD:275380 2/23 (9%)
Lrrc74aNP_001182696.1 LRR_RI 73..333 CDD:393385 64/293 (22%)
leucine-rich repeat 148..176 CDD:275380 11/37 (30%)
leucine-rich repeat 177..204 CDD:275380 6/26 (23%)
leucine-rich repeat 205..232 CDD:275380 8/36 (22%)
leucine-rich repeat 233..257 CDD:275380 4/24 (17%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
leucine-rich repeat 285..313 CDD:275380 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.